Streptomyces coeruleorubidus: CP976_04810 Help Entry CP976_04810       CDS       T07302                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism scoe  Streptomyces coeruleorubidus Pathway scoe03060   Protein export scoe03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:scoe00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     CP976_04810  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     CP976_04810  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:scoe02044]     CP976_04810 Secretion system [BR:scoe02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    CP976_04810 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  QEV23530 UniProt:  A0A5J6HYR2 LinkDB All DBs Position 1047656..1047901 Genome browser AA seq 81 aa AA seqDB search MFGLSELAILLIVVIAVIGARKLPELARSAGKSARILKAEARAAQDEEAGAAPRVVQGEI VPPGTGTTPPGARAADAPDPR NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgttcggactgagcgagctcgcgatcctcctcatcgtcgtcatagccgtgatcggagcc aggaagctgcccgaactggcccggtcggcgggcaagtcggcccgcatcctcaaggccgag gcacgcgccgcgcaggacgaggaggccggagccgcgccgcgggtggtccagggcgagatc gtcccgccgggcaccggcacgaccccgcccggcgcgcgggcggcggacgccccggacccc cgctga

DBGET integrated database retrieval system