Streptomyces coeruleorubidus: CP976_32955 Help Entry CP976_32955       CDS       T07302                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism scoe  Streptomyces coeruleorubidus Pathway scoe00253   Tetracycline biosynthesis scoe01056   Biosynthesis of type II polyketide backbone scoe01100   Metabolic pathways scoe01110   Biosynthesis of secondary metabolites Module scoe_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite KEGG Orthology (KO) [BR:scoe00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     CP976_32955    00253 Tetracycline biosynthesis     CP976_32955  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:scoe01004]     CP976_32955    01008 Polyketide biosynthesis proteins [BR:scoe01008]     CP976_32955 Lipid biosynthesis proteins [BR:scoe01004]  Polyketide synthase   Component type    CP976_32955 Polyketide biosynthesis proteins [BR:scoe01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      CP976_32955     Nonaketide PKS      CP976_32955     Decaketide PKS      CP976_32955 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PRD DUF7080 Motif Other DBs NCBI-ProteinID:  QEV28455 UniProt:  A0A5J6IIH1 LinkDB All DBs Position 7124802..7125056 Genome browser AA seq 84 aa AA seqDB search MAELSLAELREIMRQSLGEDEVPDLADADTVTFEDLGLDSLAVLETVNHIERTYGVKLPE EELAEVRTPHSMLIFVNERLRAAA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggctgagctcagcctggcggaactgcgggagatcatgcggcagagcctgggggaggac gaggtccccgaccttgcggacgcggacaccgtgaccttcgaggacctcgggctcgactcc ctggccgtcctggaaaccgtcaaccacatcgagcggacctatggcgtgaagctgcccgag gaggaactggcggaggtcaggacgccgcacagcatgctgatcttcgtcaacgagaggctg cgagcggcggcatga

DBGET integrated database retrieval system