Staphylococcus cohnii: BZ166_12165 Help Entry BZ166_12165       CDS       T05008                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism scoh  Staphylococcus cohnii Pathway scoh01100   Metabolic pathways scoh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scoh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BZ166_12165    00074 Mycolic acid biosynthesis     BZ166_12165   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BZ166_12165 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Ribosomal_L50 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  AQM42035 UniProt:  A0A2T4LSA9 LinkDB All DBs Position complement(2544877..2545110) Genome browser AA seq 77 aa AA seqDB search MENFDKVKDIIVDRLGVDAEKVTQDASFKDDLGADSLDIAELVMELEDEFGTEIPDEEAE KINTVGDAVNFINSMEK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt gtggaaaacttcgacaaagtaaaagatatcatcgttgaccgtttaggtgttgacgctgaa aaagtaactcaagatgcatctttcaaagatgatttaggcgctgactcacttgatattgct gaattagttatggaattagaagacgaatttggtactgaaattccagatgaagaagctgaa aaaatcaacactgttggtgatgcagttaactttatcaatagtatggaaaaataa

DBGET integrated database retrieval system