Siccibacter colletis: KFZ77_07330 Help Entry KFZ77_07330       CDS       T08544                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism scol  Siccibacter colletis Pathway scol01100   Metabolic pathways scol01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scol00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KFZ77_07330 (acpP)    00074 Mycolic acid biosynthesis     KFZ77_07330 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KFZ77_07330 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 HLH TerB DUF1896 Motif Other DBs NCBI-ProteinID:  UYU33311 LinkDB All DBs Position 1534646..1534882 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNGASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaatcatcggcgaacagctgggcgttaagcag gaagaagttactaacggtgcttcttttgttgaagacctgggcgctgattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggtcaccaggcgtaa

DBGET integrated database retrieval system