Siccibacter colletis: KFZ77_11570 Help Entry KFZ77_11570       CDS       T08544                                  Name (GenBank) DinI family protein   KO K12149   DNA-damage-inducible protein I Organism scol  Siccibacter colletis Brite KEGG Orthology (KO) [BR:scol00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:scol03400]     KFZ77_11570 DNA repair and recombination proteins [BR:scol03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     KFZ77_11570 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI RWD Motif Other DBs NCBI-ProteinID:  UYU30526 LinkDB All DBs Position complement(2387378..2387611) Genome browser AA seq 77 aa AA seqDB search MRVEVMIDRNKKLPEGAIPALEAELVKRLMNNYPDCKLNIRRAGTDGLNVLGADKSDKKS IEEILQETWESADEWFY NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagagttgaagtgatgatcgaccgcaacaaaaaactgccggaaggggcaatccctgct ttagaagccgaactggttaagcgcctcatgaacaactaccccgactgtaaactgaatatc cgccgcgcgggtactgatggactgaatgttcttggtgctgacaaatctgacaaaaaaagt atcgaggagattcttcaggaaacatgggaaagtgcggatgagtggttttattga

DBGET integrated database retrieval system