Snodgrassella communis: PYG29_04000 Help Entry PYG29_04000       CDS       T09364                                  Symbol ftsL Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism scom  Snodgrassella communis Brite KEGG Orthology (KO) [BR:scom00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:scom03036]     PYG29_04000 (ftsL) Chromosome and associated proteins [BR:scom03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     PYG29_04000 (ftsL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL Motif Other DBs NCBI-ProteinID:  WMY92531 LinkDB All DBs Position 856710..856982 Genome browser AA seq 90 aa AA seqDB search MNKINIILLLLVLASAFAVVTVQDRSRQFFIALDKAQKGENLLNEDFSRLKLAQARLSNH QLILDASARQGLHSPALAETQMVAAPQTVK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaataaaatcaacattattttgcttttgttggtgctggcttcagcttttgctgtggta acagtacaggatcgttcgcgccagttttttattgcattggataaggcgcaaaaaggagaa aatcttctgaatgaggatttcagtcgtttaaagttagcgcaggcaagattatctaatcat cagttgattctggatgcttcagcacggcagggtttgcattcgccagcactggccgaaacg cagatggtggctgcaccgcagacagttaaatga

DBGET integrated database retrieval system