Snodgrassella communis: PYG29_06110 Help Entry PYG29_06110       CDS       T09364                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism scom  Snodgrassella communis Brite KEGG Orthology (KO) [BR:scom00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:scom03032]     PYG29_06110    03036 Chromosome and associated proteins [BR:scom03036]     PYG29_06110    03400 DNA repair and recombination proteins [BR:scom03400]     PYG29_06110 DNA replication proteins [BR:scom03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     PYG29_06110 Chromosome and associated proteins [BR:scom03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     PYG29_06110 DNA repair and recombination proteins [BR:scom03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       PYG29_06110 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 UBA_HYPK Motif Other DBs NCBI-ProteinID:  WMY91025 LinkDB All DBs Position 1342551..1342820 Genome browser AA seq 89 aa AA seqDB search MNKSELIEAIAQEADLSKASAAKALDGMISAVTNALKGGDTVTLVGFGTFYVGERAARAG RNPKTGEPLEIKAAKTPKFRAGKALKDAL NT seq 270 nt NT seq  +upstreamnt  +downstreamnt gtgaataagtctgaattgattgaagctattgcccaagaagctgatttatctaaagcttct gcagctaaagctctagatggtatgattagcgctgttaccaatgcactgaaaggtggcgat acggtaactttggtgggttttggtacattttatgtaggtgagcgtgctgcccgtgctgga cgcaatcctaaaacaggtgagccattagaaatcaaagcagccaaaacacctaagttccgt gctggtaaagcactgaaagatgctctttga

DBGET integrated database retrieval system