Snodgrassella communis: PYG29_09945 Help Entry PYG29_09945       CDS       T09364                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism scom  Snodgrassella communis Pathway scom01100   Metabolic pathways scom01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scom00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PYG29_09945 (acpP)    00074 Mycolic acid biosynthesis     PYG29_09945 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PYG29_09945 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  WMY91732 LinkDB All DBs Position complement(2201647..2201886) Genome browser AA seq 79 aa AA seqDB search MDNNIEQRVKKIVAENLGVSEAEVKNESSFQEDLGADSLDIVELVMALEEAFGCEIPDEE AEKITTVQQAIDFVGAHLN NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggataacaatattgaacaacgagtaaagaagattgttgcagaaaatttaggtgtgagt gaagctgaagtaaaaaatgaatcttcttttcaggaagatctgggtgctgattcactggac atcgttgaattggtaatggcactggaagaagcttttggttgcgaaattccagacgaagaa gccgaaaaaattaccaccgtacaacaagctatcgattttgttggcgctcacttgaattaa

DBGET integrated database retrieval system