Salinivibrio costicola: HBA18_08755 Help Entry HBA18_08755       CDS       T06511                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism scot  Salinivibrio costicola Pathway scot01100   Metabolic pathways scot01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scot00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HBA18_08755 (acpP)    00074 Mycolic acid biosynthesis     HBA18_08755 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HBA18_08755 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 EutQ Motif Other DBs NCBI-ProteinID:  QIR06446 LinkDB All DBs Position 1:complement(1837326..1837562) Genome browser AA seq 78 aa AA seqDB search MSNIEERVKKIIVEQLGVDEAEVKNEASFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYVVSASE NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaacatcgaagaacgcgtaaagaaaatcatcgttgagcaactgggtgtagacgaa gcagaagtgaaaaacgaagcttctttcgtagacgacctaggcgcggactctctggatacc gtagagctagtaatggctctagaagaggaattcgatacagagattccagatgaagaagcc gaaaagattaccactgttcaagcggctatcgactacgtagttagcgcttctgagtaa

DBGET integrated database retrieval system