Sorangium cellulosum So0157-2: SCE1572_36845 Help Entry SCE1572_36845     CDS       T02718                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism scu  Sorangium cellulosum So0157-2 Pathway scu00998   Biosynthesis of various antibiotics scu01100   Metabolic pathways scu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SCE1572_36845    00074 Mycolic acid biosynthesis     SCE1572_36845   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SCE1572_36845 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AGP39575 UniProt:  S4Y5T6 LinkDB All DBs Position 10409941..10410222 Genome browser AA seq 93 aa AA seqDB search MDKGEIAAVVRRELQRIAPEADIEALDPDGDVREELDIDSMDLLRFVTALDAELGVSVPE SDYRRIATVRGCTDYLAEKLAQRAAQRAAQGRR NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggacaaaggggagatcgcggccgtcgtgcgccgggagctccagcgcatcgcgccggag gcggacatcgaggcgctggatccggacggcgacgtccgcgaggagctcgacatcgactcg atggatctcctgcgcttcgtgacggccctcgacgcggagctcggcgtgagcgtgcccgag tcggactaccggcggatcgccacggtccgcgggtgcaccgactacctggcggagaagctc gcgcagcgggcggcgcagcgcgccgcccaggggagacgatga

DBGET integrated database retrieval system