Streptomyces cyaneogriseus: TU94_21575 Help Entry TU94_21575        CDS       T03687                                  Name (GenBank) glutaredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism scw  Streptomyces cyaneogriseus Brite KEGG Orthology (KO) [BR:scw00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     TU94_21575 Enzymes [BR:scw01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      TU94_21575 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Glrx-like Thioredoxin Thioredoxin_2 GST_N_3 GST_N_2 Motif Other DBs NCBI-ProteinID:  AJP03689 UniProt:  A0A0C5G606 LinkDB All DBs Position complement(5066543..5066800) Genome browser AA seq 85 aa AA seqDB search MPGTVTMYSTTWCGYCRRLKSQLDREGIEYTEINIEQDPESAAFVEKANGGNQTVPTVRV VPAGGGEEVVMTNPSLAQVKQALAA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgccaggcactgtgacgatgtacagcaccacgtggtgcggctactgccgtcggctgaag agccagctcgaccgggagggcatcgagtacaccgagatcaacatcgagcaggacccggag tccgccgcgttcgtggagaaggcgaatggcggaaaccagacggtgccgacggtccgggtc gtccccgcgggcgggggcgaggaggtcgtcatgaccaacccgagcctcgctcaggtgaag caggctctcgccgcctga

DBGET integrated database retrieval system