Streptomyces cyaneogriseus: TU94_22540 Help Entry TU94_22540        CDS       T03687                                  Name (GenBank) ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism scw  Streptomyces cyaneogriseus Pathway scw00190   Oxidative phosphorylation scw01100   Metabolic pathways Module scw_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:scw00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     TU94_22540  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:scw00194]     TU94_22540 Photosynthesis proteins [BR:scw00194]  Photosystem and electron transport system   F-type ATPase [OT]    TU94_22540 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  AJP03831 UniProt:  A0A0C5GHD0 LinkDB All DBs Position 5352592..5352840 Genome browser AA seq 82 aa AA seqDB search MSALQTLAATNIQGNFAAIGYGLAAIGPGIGVGVIFGNGTQALARQPEAAGLIRQNQILG FVLCEALALIGLVMGFVYPVPS NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgtccgctctccagaccctcgccgcgaccaacatccagggcaacttcgctgcgatcggc tacggcctggccgccatcggccccggcatcggcgtgggcgtgatcttcggtaacggtacg caggccctcgctcggcagcccgaggccgccggcctgatccgccagaaccagatcctgggc ttcgtgctctgtgaggcgctcgccctgatcggtctggtcatgggcttcgtctacccggtg ccttcctga

DBGET integrated database retrieval system