Streptomyces cyaneogriseus: TU94_31835 Help Entry TU94_31835        CDS       T03687                                  Name (GenBank) hypothetical protein   KO K05553   minimal PKS acyl carrier protein Organism scw  Streptomyces cyaneogriseus Pathway scw00253   Tetracycline biosynthesis scw01056   Biosynthesis of type II polyketide backbone scw01100   Metabolic pathways scw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scw00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     TU94_31835    00253 Tetracycline biosynthesis     TU94_31835  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:scw01004]     TU94_31835    01008 Polyketide biosynthesis proteins [BR:scw01008]     TU94_31835 Lipid biosynthesis proteins [BR:scw01004]  Polyketide synthase   Component type    TU94_31835 Polyketide biosynthesis proteins [BR:scw01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      TU94_31835     Nonaketide PKS      TU94_31835     Decaketide PKS      TU94_31835 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF2096_N Motif Other DBs NCBI-ProteinID:  AJP05333 UniProt:  A0A0C5G5P7 LinkDB All DBs Position 7598472..7598720 Genome browser AA seq 82 aa AA seqDB search MLSLDQLLQILGECSGDEQITAQGEDVLDREFDALGYDSLVLLETSAQLKHRHDIDIPED VIRDLKTPRAVLEYVNVPASRD NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgctcagcctcgaccagcttctgcagatcctcggcgagtgctccggcgacgagcagatc accgcccagggagaggacgtcctcgaccgcgagttcgacgccctcggctacgactccctg gtcctgctggagacctccgcccagctcaagcaccgccacgacatcgacatccccgaggac gtcatccgcgacctgaagaccccgcgcgccgtcctggaatacgtcaacgtgcccgcgagc cgggactag

DBGET integrated database retrieval system