Streptomyces sp. CdTB01: AS200_16650 Help Entry AS200_16650       CDS       T04240                                  Name (GenBank) ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism scx  Streptomyces sp. CdTB01 Pathway scx00190   Oxidative phosphorylation scx01100   Metabolic pathways Module scx_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:scx00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     AS200_16650  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:scx00194]     AS200_16650 Photosynthesis proteins [BR:scx00194]  Photosystem and electron transport system   F-type ATPase [OT]    AS200_16650 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  ALV33486 UniProt:  A0A0U3G448 LinkDB All DBs Position complement(3782751..3782990) Genome browser AA seq 79 aa AA seqDB search MSAAIDLAAGVSGSLGSIGYGLAAIGPGIGIGIIFGNGTQALARQPEAAGLIRANQILGF AFCEALALIGIVMPFVFGQ NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtccgctgccatcgacctcgccgccggcgtctcgggttccctcggttccatcggttac ggcctcgcggccatcggccccggcatcggtatcggcatcatcttcggtaacggcacccag gccctcgcccgtcagcccgaggcggccggtctgatccgcgccaaccagatcctgggcttc gcgttctgtgaggcgctcgccctcatcggcatcgttatgccgttcgtgttcggtcagtaa

DBGET integrated database retrieval system