Streptomyces sp. CdTB01: AS200_17910 Help Entry AS200_17910       CDS       T04240                                  Name (GenBank) NrdH-redoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism scx  Streptomyces sp. CdTB01 Brite KEGG Orthology (KO) [BR:scx00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     AS200_17910 Enzymes [BR:scx01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      AS200_17910 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 GST_N_2 Glrx-like Thioredoxin GST_N_3 Motif Other DBs NCBI-ProteinID:  ALV33708 UniProt:  A0A0U3Q1S9 LinkDB All DBs Position 4048960..4049202 Genome browser AA seq 80 aa AA seqDB search MPGTVTMYSTTWCGYCRRLKSQMDREGITYDEINIEQDPESAAFVEKANGGNQTVPTVLF PDGSTLTNPSLAQVKQKIGV NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgccgggcactgtgacgatgtacagcaccacgtggtgtggctactgccgtcggctgaag agccagatggaccgcgagggcatcacgtacgacgagatcaacatcgagcaggacccggag tccgccgctttcgtggagaaggcgaatggcggaaaccagacggttccgaccgtgctgttc ccggacggttcgacgctgaccaacccgtcgctggcccaggtgaagcagaagatcggcgtg tga

DBGET integrated database retrieval system