Streptomyces sp. CdTB01: AS200_30655 Help Entry AS200_30655       CDS       T04240                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism scx  Streptomyces sp. CdTB01 Pathway scx00998   Biosynthesis of various antibiotics scx01100   Metabolic pathways scx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scx00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AS200_30655    00074 Mycolic acid biosynthesis     AS200_30655   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AS200_30655 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  ALV35925 UniProt:  A0A0U3PW94 LinkDB All DBs Position complement(6904818..6905066) Genome browser AA seq 82 aa AA seqDB search MAATQEEIVAGLADIVNEIAGIPVEDVQLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DEDVKNLKTVGDATDYILKHQA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccactcaggaagagatcgtcgccggtctcgccgacatcgtgaacgagatcgcc ggcatcccggttgaggacgtccagctggacaagtccttcaccgacgacctggacgtcgac tcgctgtccatggtcgaggtcgtcgtcgccgccgaagagcgcttcgacgtcaagatcccg gacgaggacgtcaagaacctcaagaccgtcggcgacgcgaccgactacatcctcaagcac caggcctga

DBGET integrated database retrieval system