Streptomyces cyaneochromogenes: EJ357_30605 Help Entry EJ357_30605       CDS       T06811                                  Name (GenBank) mycoredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism scya  Streptomyces cyaneochromogenes Brite KEGG Orthology (KO) [BR:scya00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     EJ357_30605 Enzymes [BR:scya01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      EJ357_30605 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 Glrx-like GST_N_2 Thioredoxin GST_N_3 Thioredoxin_7 Motif Other DBs NCBI-ProteinID:  AZQ37264 UniProt:  A0A3S9MDK2 LinkDB All DBs Position complement(6697718..6697960) Genome browser AA seq 80 aa AA seqDB search MQGTVTMYSTTWCGYCQRLKKQLDREGIAYTEINIEHDPASAAFVEKANGGNQTVPTVLF ADGSTLTNPSLAQVKQKISA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgcagggcactgtgacgatgtacagcacgacgtggtgcggttactgccagcggctgaag aagcagctggaccgcgagggcatcgcgtacaccgagatcaacatcgagcacgaccccgcg tccgccgcgttcgtcgagaaggcgaatggcggaaaccagacggtcccgacggtgctcttc gcggacggttccacgctgacgaacccgtcgctggcgcaggtgaagcagaagatcagcgcg taa

DBGET integrated database retrieval system