Stenotrophomonas cyclobalanopsidis: AB1723_00735 Help Entry AB1723_00735      CDS       T10607                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism scyc  Stenotrophomonas cyclobalanopsidis Pathway scyc01100   Metabolic pathways scyc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scyc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AB1723_00735 (acpP)    00074 Mycolic acid biosynthesis     AB1723_00735 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AB1723_00735 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C HLH Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  XCZ87720 LinkDB All DBs Position 138306..138545 Genome browser AA seq 79 aa AA seqDB search MSTIEERVKKIVVEQLGVKEEEVTNSASFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKISTVQAAIDYIKAHVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgtcgtcgaacagcttggcgtcaaggaa gaagaagtcaccaacagcgcatcgttcgtcgatgacctgggcgctgactcgctggacacc gttgagctggtgatggccctggaagaagagttcgagtgcgagatcccggacgaagaagcc gagaagatcagcaccgtgcaggccgccatcgactacatcaaggcccacgtcaaggcctga

DBGET integrated database retrieval system