Streptomyces cyaneofuscatus: R2B67_13395
Help
Entry
R2B67_13395 CDS
T09646
Symbol
rplR
Name
(GenBank) 50S ribosomal protein L18
KO
K02881
large subunit ribosomal protein L18
Organism
scye
Streptomyces cyaneofuscatus
Pathway
scye03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
scye00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
R2B67_13395 (rplR)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
scye03011
]
R2B67_13395 (rplR)
Ribosome [BR:
scye03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
R2B67_13395 (rplR)
Bacteria
R2B67_13395 (rplR)
Archaea
R2B67_13395 (rplR)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
CsgH
Motif
Other DBs
NCBI-ProteinID:
WOP09501
LinkDB
All DBs
Position
complement(3143747..3144130)
Genome browser
AA seq
127 aa
AA seq
DB search
MAYGVKIAKGDAYKRAARKRRHIRVRKHMSGSPERPRLVVTRSNRHIVAQVIDDIAGHTL
ASASTLDTSIRGGEGDKSAQAQQVGALVAERAKAAGVEAVVFDRGGNQYAGRIAALADAA
REAGLKF
NT seq
384 nt
NT seq
+upstream
nt +downstream
nt
atggcatacggtgtgaagatcgccaagggcgacgcttacaagcgcgctgctcgcaagcgc
cgccacatccgcgtccgcaagcacatgtcgggttcgccggagcgtccccgtctggtcgtg
acgcgttccaaccgccacatcgtggcccaggtcatcgacgacatcgcgggccacacgctc
gcgtcggcgtcgaccctggacacctcgatccgtggtggcgagggtgacaagagcgcccag
gcccagcaggtcggcgccctggtcgccgagcgcgccaaggccgcaggcgtcgaggccgtc
gtgtttgaccgcggtggtaaccagtacgccgggcggattgccgctctggctgacgccgcc
cgtgaagccgggctgaagttctaa
DBGET
integrated database retrieval system