Streptomyces cyaneofuscatus: R2B67_20000 Help Entry R2B67_20000       CDS       T09646                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism scye  Streptomyces cyaneofuscatus Pathway scye00998   Biosynthesis of various antibiotics scye01100   Metabolic pathways scye01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scye00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     R2B67_20000    00074 Mycolic acid biosynthesis     R2B67_20000   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     R2B67_20000 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  WOP10682 LinkDB All DBs Position 4525730..4526011 Genome browser AA seq 93 aa AA seqDB search MERQELVLTIEKALSEVLERPVSGLTEETALFDELQLTSLAVLGMLMSVEEATGISVDPE GLDIDDLRTLGSFADYVEAAIRKEETREEEGAS NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggaacgtcaggaacttgtgctgaccatcgagaaggcgctcagcgaggtgctggagcgg ccggtcagcgggctcacggaggagaccgcgctcttcgacgagctccagctcacctccctc gccgtgttggggatgctgatgagcgtcgaggaggcgaccgggatctcggtcgacccggag gggctcgacatcgacgacctgcggacgctggggtccttcgccgactacgtcgaggccgcg atccgcaaggaagagactcgcgaagaagagggggcgtcatga

DBGET integrated database retrieval system