Streptomyces cyaneofuscatus: R2B67_23005 Help Entry R2B67_23005       CDS       T09646                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism scye  Streptomyces cyaneofuscatus Brite KEGG Orthology (KO) [BR:scye00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:scye03032]     R2B67_23005    03036 Chromosome and associated proteins [BR:scye03036]     R2B67_23005    03400 DNA repair and recombination proteins [BR:scye03400]     R2B67_23005 DNA replication proteins [BR:scye03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     R2B67_23005 Chromosome and associated proteins [BR:scye03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     R2B67_23005 DNA repair and recombination proteins [BR:scye03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       R2B67_23005 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding Urease_beta A_thal_3526 HU-HIG Motif Other DBs NCBI-ProteinID:  WOP11224 LinkDB All DBs Position 5222894..5223175 Genome browser AA seq 93 aa AA seqDB search MNRSELVAALADRAEVTRKDADAVLAALAETVGEIVAKGDEKVTIPGFLTFERTHRAART ARNPQTGDPINIPAGYSVKVSAGSKLKEAAKGK NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaccgcagtgagctggtggccgccctggccgaccgcgccgaggtgactcgcaaggac gccgacgccgtgctggccgcgctcgccgagaccgtcggtgagatcgtcgccaagggcgac gagaaggtcaccatccccggcttcctgaccttcgagcgcacccaccgtgccgctcgcacc gctcgcaacccgcagaccggcgacccgatcaacatccccgccggctacagcgtgaaggtc tccgcgggctcgaagctcaaggaagccgccaagggtaagtaa

DBGET integrated database retrieval system