Streptomyces cyaneofuscatus: R2B67_26525 Help Entry R2B67_26525       CDS       T09646                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism scye  Streptomyces cyaneofuscatus Pathway scye00998   Biosynthesis of various antibiotics scye01100   Metabolic pathways scye01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scye00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     R2B67_26525    00074 Mycolic acid biosynthesis     R2B67_26525   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     R2B67_26525 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  WOP11877 LinkDB All DBs Position complement(6033956..6034204) Genome browser AA seq 82 aa AA seqDB search MAATQEEIVTGLAEIVNEIAGIPVEDVQLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DEDVKNLKTVGDAADYILKHQG NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccacgcaggaagagatcgtcaccggtctcgccgagatcgtcaacgagatcgcc ggtatcccggtcgaggacgtccagctggacaagtccttcaccgacgacctggacgtcgac tcgctgtccatggtcgaggtcgtcgtcgccgccgaggagcgcttcgacgtcaagatcccc gacgaggacgtcaagaacctcaagacggtcggcgacgctgccgactacatcctgaagcac cagggctga

DBGET integrated database retrieval system