Streptomyces cynarae: N8I84_12675 Help Entry N8I84_12675       CDS       T09435                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism scyn  Streptomyces cynarae Pathway scyn00253   Tetracycline biosynthesis scyn01056   Biosynthesis of type II polyketide backbone scyn01100   Metabolic pathways scyn01110   Biosynthesis of secondary metabolites Module scyn_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite KEGG Orthology (KO) [BR:scyn00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     N8I84_12675    00253 Tetracycline biosynthesis     N8I84_12675  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:scyn01004]     N8I84_12675    01008 Polyketide biosynthesis proteins [BR:scyn01008]     N8I84_12675 Lipid biosynthesis proteins [BR:scyn01004]  Polyketide synthase   Component type    N8I84_12675 Polyketide biosynthesis proteins [BR:scyn01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      N8I84_12675     Nonaketide PKS      N8I84_12675     Decaketide PKS      N8I84_12675 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 PRD Motif Other DBs NCBI-ProteinID:  UXY19487 LinkDB All DBs Position unmamed1:2712804..2713076 Genome browser AA seq 90 aa AA seqDB search MTVQTVTGLNIDDIRRILIESAGFDGAPDPATDISDIPFEELGYDSLALMESAARIQQEY GIRIPDDEITEVETPRALLGLVNTGLSAAA NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaccgtccagaccgtcaccggcctgaacatcgacgacatccggcggatcctgatcgag agcgcgggcttcgacggcgcgcccgatccggccaccgacatcagcgacatccccttcgag gagctcggctacgactcgctcgcgctgatggagagcgccgcgcggatccagcaggagtac ggcatccgcatacccgacgacgagatcaccgaggtcgagacgccccgcgcccttctcggc ctggtcaacaccggcctctccgccgccgcctga

DBGET integrated database retrieval system