Shewanella cyperi: JYB88_17090 Help Entry JYB88_17090       CDS       T07829                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism scyp  Shewanella cyperi Pathway scyp01100   Metabolic pathways scyp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scyp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JYB88_17090    00074 Mycolic acid biosynthesis     JYB88_17090   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JYB88_17090 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding CagD Motif Other DBs NCBI-ProteinID:  QSX29873 UniProt:  A0A974XMB7 LinkDB All DBs Position 3861309..3861557 Genome browser AA seq 82 aa AA seqDB search MQNREQILEMLMGILVDEFEIDAAAITPEASLYQDLDLDSIDAVDLVIKLQQLTGKKIQP DEFKSVRTVDDVINAIEGLVKA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcagaatcgcgaacaaattctggaaatgctcatgggcatattggtagacgaattcgaa atcgacgctgcggctatcactcccgaagcctccctgtatcaggatctggatctggacagc atagacgcggtggatttggtcattaagctgcaacagctgaccggcaaaaaaatccaaccg gacgaattcaaatccgtccgtactgtcgatgacgtaatcaatgccattgaaggcttggtt aaagcctga

DBGET integrated database retrieval system