Streptomyces sp. CFMR 7: ABE83_23235 Help Entry ABE83_23235       CDS       T04074                                  Name (GenBank) integration host factor   KO K03530   DNA-binding protein HU-beta Organism scz  Streptomyces sp. CFMR 7 Brite KEGG Orthology (KO) [BR:scz00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:scz03032]     ABE83_23235    03036 Chromosome and associated proteins [BR:scz03036]     ABE83_23235    03400 DNA repair and recombination proteins [BR:scz03400]     ABE83_23235 DNA replication proteins [BR:scz03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     ABE83_23235 Chromosome and associated proteins [BR:scz03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     ABE83_23235 DNA repair and recombination proteins [BR:scz03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       ABE83_23235 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding Urease_beta A_thal_3526 HU-HIG Motif Other DBs NCBI-ProteinID:  ALC29648 UniProt:  A0A0M5IXF7 LinkDB All DBs Position 5538176..5538457 Genome browser AA seq 93 aa AA seqDB search MNRSELVAALADRAEVTRKDADAVLAALAETVGEIVAKGDEKVTIPGFLTFERTHRAART ARNPQTGDPINIPAGYSVKVSAGSKLKEAAKGK NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaccgcagtgagctggtggccgccctggccgaccgtgccgaggtgacccgcaaggac gccgacgccgtgctggccgcgctcgccgagaccgtcggtgagatcgtcgccaagggcgac gagaaggtcaccatccccggcttcctgaccttcgagcgcacccaccgtgccgctcgcacc gcgcgcaacccgcagaccggcgacccgatcaacatccccgccggctacagcgtgaaggtc tccgcgggctcgaagctcaaggaagccgccaagggcaagtaa

DBGET integrated database retrieval system