Stutzerimonas degradans: GOM96_09460 Help Entry GOM96_09460       CDS       T08431                                  Name (GenBank) TIGR02449 family protein   KO K09892   cell division protein ZapB Organism sdeg  Stutzerimonas degradans Brite KEGG Orthology (KO) [BR:sdeg00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sdeg03036]     GOM96_09460 Chromosome and associated proteins [BR:sdeg03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     GOM96_09460 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  USHBP1_PDZ-bd Macoilin DUF2458 Matrilin_ccoil ZapB MIT Motif Other DBs NCBI-ProteinID:  QGW21199 LinkDB All DBs Position 2061376..2061585 Genome browser AA seq 69 aa AA seqDB search MEDADLRLLTAKLEQLLQRIEQLKAQNHLLLANERAWREERAHLIEKNELARLKVESMIS RLKALEQDS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaagacgccgatctgcgattgctgaccgccaagctggaacaattgctccagcgcatc gagcaactcaaggcacagaaccacctgctgctggccaacgagcgggcctggcgcgaagag cgcgctcatctgatcgaaaagaacgaattggcccggctgaaggtcgaatcgatgatttcg cgcctgaaagccctggagcaggactcatga

DBGET integrated database retrieval system