KEGG   Stutzerimonas degradans: GOM96_11375
Entry
GOM96_11375       CDS       T08431                                 
Symbol
uvrD
Name
(GenBank) DNA helicase II
  KO
K03657  ATP-dependent DNA helicase UvrD/PcrA [EC:5.6.2.4]
Organism
sdeg  Stutzerimonas degradans
Pathway
sdeg03420  Nucleotide excision repair
sdeg03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sdeg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    GOM96_11375 (uvrD)
   03430 Mismatch repair
    GOM96_11375 (uvrD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sdeg03400]
    GOM96_11375 (uvrD)
Enzymes [BR:sdeg01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     GOM96_11375 (uvrD)
DNA repair and recombination proteins [BR:sdeg03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     GOM96_11375 (uvrD)
   MMR (mismatch excision repair)
    Other MMR factors
     GOM96_11375 (uvrD)
SSDB
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 PcrA_UvrD_tudor UvrD_C_2 AAA_30 AAA_11 AAA_22 DUF3553
Other DBs
NCBI-ProteinID: QGW21560
LinkDB
Position
complement(2446656..2448845)
AA seq 729 aa
MHDDLSLLLNSLNDAQRQAVAAPLGRQLVLAGAGSGKTRVLVHRIAWLHQVERASLHSIL
SVTFTNKAAAEMRQRIEQLLHVNPQGLWVGTFHGLAHRLLRAHWQEAKLDQNFQILDSDD
QQRLVKRVIRELGLDEQRWPARQAQWWINAQKDEGLRPQNIQAGGDLFLATQLKIYEAYE
QACVRAGVIDFSELLLRALDLWRNHPGLLEHYQRRFRHVLVDEFQDTNAVQYAWLRLLAR
GGGSLMVVGDDDQSIYGWRGARIENLQQFSQDFPDAETIRLEQNYRSTACILKAANALIA
NNQGRLGKELWTEGCEGEPISLYAAFNEHDEARYVVESIEKAIRDGLSRSEIAILYRSNA
QSRVLEEALLREKIPYRIYGGQRFFERAEIKNAMAYLRLIQTRHNDAALERVINLPARGI
GEKTVETLRQLARQEEISLWAALHQAVGTKLVSGRAASALNGFVELIDTLALKVEGMQLH
SMAQLVIEQSGLLAYHRDEKGEKAQARVENLEELVSAARAFDNYSEEDDDVQSPLAAFLD
HASLEAGEQQAGDHEDSVQLMTLHSAKGLEFPLVFLVGMEEGLFPHKMSLEESGRLEEER
RLAYVGITRAMQQLVITYAETRRLYGSETYNKVSRFVREIPPALIQEVRLSNTVTRSFSG
KNMGGGSLFDGAGVPDTPFNLGQRVRHALFGEGTILNFEGSGAQARVQVNFEDEGSKWLM
LSYAKLEAL
NT seq 2190 nt   +upstreamnt  +downstreamnt
atgcatgacgatctctctctcctcctgaattccctcaacgatgcccagcgccaggccgtg
gccgcgccgctggggcgtcaattggtgttggccggcgccggctcgggcaagacccgcgtg
ctggtgcaccgcatcgcctggctgcaccaggtcgaacgcgcctcgctgcactcgatcctc
tcggtgaccttcaccaacaaggccgccgcggagatgcgtcagcgcatcgagcagctgctg
catgtgaacccgcagggcctgtgggttggcaccttccacggcctcgcgcaccgcctgctg
cgcgcccactggcaggaagcgaaactggaccagaatttccagattctcgattccgacgac
cagcaacggctggtcaagcgggtaatccgcgagctcggcctcgacgagcagcgctggccg
gcgcgccaggcgcagtggtggatcaatgcgcagaaggacgagggcctgcgcccgcagaac
atccaggccggcggcgacctgttcctcgccacccagttgaagatctacgaggcctacgag
caggcctgcgtccgcgccggggtgatcgacttctccgagctgctgctgcgtgccctcgac
ctgtggcgcaatcatccgggcctgctggagcactaccagcggcgtttccgccacgtgctg
gtggacgaattccaagacaccaacgccgtgcagtacgcctggctgcgcctcttggcccgc
ggcggcgggagcctgatggtggtgggcgacgatgaccagtcgatctacggctggcgcggc
gcgcggatcgagaatctgcagcagttcagtcaggatttccccgacgccgagaccatccgt
ctggagcagaactaccgctccaccgcctgcatcctcaaggccgccaacgcactgatcgcc
aacaaccagggccgcctgggcaaagagctgtggaccgagggctgcgaaggcgagccgatc
agcctgtacgccgccttcaacgagcacgacgaagcgcgctacgtggtcgagagcatcgag
aaggccatccgcgacggtctgagtcgcagcgaaattgccatcctctaccgttccaacgca
cagtcacgggtgctggaagaggcgctgctgcgcgagaagattccctaccgcatctacggc
ggccagcgcttcttcgagcgcgccgagatcaagaacgccatggcctacctgcgcctgatc
cagacccgtcacaacgacgcggcgctggaacgggtgatcaacctgccggcgcgcggcatc
ggcgagaagaccgtcgagaccctgcgccaactggcgcgccaggaggagatctcgctgtgg
gcggcgctgcaccaggcggtcggcaccaagctcgtctccggccgcgccgccagcgcgctg
aacggcttcgtcgaactgatcgacaccctcgcgctgaaggtcgagggcatgcagctgcac
agcatggcgcagctggtcatcgaacagtccggtctgctcgcctaccaccgcgacgaaaag
ggcgagaaggcccaggcgcgggtggagaacctcgaggaactggtgtccgccgcgcgcgcc
ttcgacaactacagcgaagaggacgacgacgtccagtcaccgctggcagcctttctcgac
cacgcctcgctggaggccggcgagcagcaggccggcgaccacgaggacagcgtgcagctg
atgacgctgcacagcgccaagggtctggagtttccattggtgttcctggtcggcatggaa
gaaggcctgttcccgcacaagatgagcctggaggagtccggccgcctggaagaggaacgc
cgcctggcctacgtcggcatcacccgcgccatgcagcagctggtgatcacctacgccgaa
acgcgccggctgtacggcagcgagacctacaacaaggtctcgcgcttcgtccgcgagatc
ccgccggcgctgattcaggaagtgcggctgagcaacacggtgacgcgctcgttcagcggc
aagaacatgggcggcggctcgctgttcgacggtgccggcgtgccggacaccccgttcaac
ctcggccagcgcgtgcgccatgcgctgttcggcgagggcaccatcctcaacttcgaaggc
tccggcgcccaggcacgggtgcaggtgaatttcgaggatgaaggcagcaagtggctgatg
ctcagctacgccaagctcgaagcgctctga

DBGET integrated database retrieval system