Steroidobacter denitrificans: ACG33_04405 Help Entry ACG33_04405       CDS       T04296                                  Name (GenBank) hypothetical protein   KO K02183   calmodulin Organism sdf  Steroidobacter denitrificans Brite KEGG Orthology (KO) [BR:sdf00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:sdf01009]     ACG33_04405   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sdf04131]     ACG33_04405    03036 Chromosome and associated proteins [BR:sdf03036]     ACG33_04405   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sdf04147]     ACG33_04405 Protein phosphatases and associated proteins [BR:sdf01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      ACG33_04405 Membrane trafficking [BR:sdf04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     ACG33_04405 Chromosome and associated proteins [BR:sdf03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      ACG33_04405 Exosome [BR:sdf04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    ACG33_04405 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EF-hand_10 Motif Other DBs NCBI-ProteinID:  AMN46359 UniProt:  A0A127F9X4 LinkDB All DBs Position 1011718..1011960 Genome browser AA seq 80 aa AA seqDB search MSAANIPSRYAADTDELRKEFASVDKNGDGRVSFEEFKQLLDGLESGLSEPEMRIGFREV DTDRDGRIDCREFIEWWTSD NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgtccgcagcgaacatcccgtcacgatatgccgccgataccgacgaactcaggaaggaa ttcgcttcggtcgacaagaatggtgatggacgtgtgagtttcgaggagttcaagcagttg ctcgatggcctcgagagcggcctgtccgagccggaaatgcgcatcggctttcgtgaagtc gacacggaccgcgacggacgtatcgattgtcgggaattcatcgagtggtggaccagtgat tga

DBGET integrated database retrieval system