Steroidobacter denitrificans: ACG33_06105 Help Entry ACG33_06105       CDS       T04296                                  Name (GenBank) hypothetical protein   KO K09892   cell division protein ZapB Organism sdf  Steroidobacter denitrificans Brite KEGG Orthology (KO) [BR:sdf00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sdf03036]     ACG33_06105 Chromosome and associated proteins [BR:sdf03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     ACG33_06105 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB JAKMIP_CC3 GAS Retinal DUF7491 SWIRM-assoc_1 STAT_alpha APG6_N YabA DUF2203 DUF1664 FapA Mis12 UPF0449 Motif Other DBs NCBI-ProteinID:  AMN46674 UniProt:  A0A127F8C8 LinkDB All DBs Position complement(1362746..1362979) Genome browser AA seq 77 aa AA seqDB search MSAANPPADLEQELRQLERRLDEFVALSARLQEENRALRQRQDSMMAERAALLQKNEQVR GRVEAMIGRLKAMEHSA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgcagccaacccaccggcagatctcgaacaggagctaaggcagctggaacggcgg ctcgatgagttcgtggcgctgtctgctcgcctgcaagaagaaaatcgcgctctgcgccag cggcaggattcgatgatggccgagcgtgcggccctgttgcaaaagaatgagcaggttcgc ggccgggtcgaggcgatgatcggacgcttgaaggcgatggagcacagcgcatga

DBGET integrated database retrieval system