Steroidobacter denitrificans: ACG33_07750 Help Entry ACG33_07750       CDS       T04296                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sdf  Steroidobacter denitrificans Pathway sdf01100   Metabolic pathways sdf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sdf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ACG33_07750    00074 Mycolic acid biosynthesis     ACG33_07750   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ACG33_07750 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1493 DUF1896 HLH Motif Other DBs NCBI-ProteinID:  AMN46990 UniProt:  A0A127FBL2 LinkDB All DBs Position 1715357..1715599 Genome browser AA seq 80 aa AA seqDB search MSSIEQQVKAIVAEQLGVKEEEVTNDASFVDDLGADSLDTVELVMALEEEFETEIPDEDA EKITTVQQAIDYITERRNQA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgagcagtatcgaacagcaagttaaagccatcgtcgccgagcagttgggggtgaaggag gaagaagtcaccaacgatgcttccttcgtcgatgacctcggcgcggactcgctcgacacc gtcgagctggtcatggcgttggaggaggagttcgagaccgagatccccgacgaggatgcg gaaaagatcaccaccgttcagcaggcgatcgattacatcaccgagcgtcgtaaccaggcc tga

DBGET integrated database retrieval system