Selenomonas dianae: QU667_00760 Help Entry QU667_00760       CDS       T09257                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism sdia  Selenomonas dianae Pathway sdia00020   Citrate cycle (TCA cycle) sdia00720   Other carbon fixation pathways sdia01100   Metabolic pathways sdia01110   Biosynthesis of secondary metabolites sdia01120   Microbial metabolism in diverse environments sdia01200   Carbon metabolism sdia01210   2-Oxocarboxylic acid metabolism Module sdia_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:sdia00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     QU667_00760   09102 Energy metabolism    00720 Other carbon fixation pathways     QU667_00760 Enzymes [BR:sdia01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      QU667_00760 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_10 Fer4_9 Fer4_2 Fer4_6 Fer4_21 Fer4_16 Fer4_17 Fer4_8 Fer4_4 LdpA_Fe-S-bd Fer4_15 Fer4_22 Fer4_13 Fer4_3 Motif Other DBs NCBI-ProteinID:  WLD82548 LinkDB All DBs Position complement(164019..164213) Genome browser AA seq 64 aa AA seqDB search MKGELYIKEKRCKGCGICAAFCPKKVLEVSLLGKITPARPEDCIACGQCEMRCPDFAIFV ERRA NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atgaagggtgagctgtatatcaaggaaaagcggtgcaagggctgcgggatatgtgcagcg ttctgtccgaagaaggtgcttgaggtgagtctgctcggcaagatcacgcccgcccgcccc gaggactgcatcgcgtgcgggcagtgcgagatgcgctgtcccgattttgcgatattcgta gagaggagggcgtga

DBGET integrated database retrieval system