KEGG   Selenomonas dianae: QU667_04320
Entry
QU667_04320       CDS       T09257                                 
Symbol
coaD
Name
(GenBank) pantetheine-phosphate adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
sdia  Selenomonas dianae
Pathway
sdia00770  Pantothenate and CoA biosynthesis
sdia01100  Metabolic pathways
sdia01240  Biosynthesis of cofactors
Module
sdia_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:sdia00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    QU667_04320 (coaD)
Enzymes [BR:sdia01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     QU667_04320 (coaD)
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Other DBs
NCBI-ProteinID: WLD83199
LinkDB
Position
885806..886300
AA seq 164 aa
MRRAVFAGSFDPVTTGHIDIVERAASMFDELVVCIFHNIRKDGCFPLDERVRFLREATAH
VSNARVDVFSGLLTDYMKQQNARVVVRGLRSVKDFEYEENHAAMIRHLMPESDTIFLLTR
PDLTFVSSSGVRELIRFRGPVQGIVPPAVERAILKLYGKKPPLE
NT seq 495 nt   +upstreamnt  +downstreamnt
atgagacgcgcggtttttgcgggcagttttgaccccgtgacgacggggcatattgatatt
gtggagcgtgcggcatcgatgttcgatgaactcgttgtctgcatttttcacaacatccgg
aaggatggttgttttcctctggatgagcgcgtccgcttcctgcgggaggcgaccgcccat
gtgtcgaatgcacgcgtggatgtgttctcgggactcctgacagactatatgaagcagcag
aatgctcgggttgtggtgcgcggtctgcgttcggtgaaggatttcgagtatgaggagaat
catgcggcgatgattcgccacctcatgccggaaagtgatacgatatttttgctgacgcgc
cccgatctgacctttgtcagttcctcgggggtgcgtgagctgattcgcttccgcggaccg
gtgcaggggattgttccgccggcggtcgagcgggcaatattgaagctgtatggaaaaaag
ccccctctggaatag

DBGET integrated database retrieval system