KEGG   Sulfurimonas diazotrophicus: WCY31_02370
Entry
WCY31_02370       CDS       T11008                                 
Symbol
truB
Name
(GenBank) tRNA pseudouridine(55) synthase TruB
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
sdiz  Sulfurimonas diazotrophicus
Brite
KEGG Orthology (KO) [BR:sdiz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sdiz03016]
    WCY31_02370 (truB)
Enzymes [BR:sdiz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     WCY31_02370 (truB)
Transfer RNA biogenesis [BR:sdiz03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    WCY31_02370 (truB)
 Prokaryotic type
    WCY31_02370 (truB)
SSDB
Motif
Pfam: TruB_N
Other DBs
NCBI-ProteinID: XAU15552
UniProt: A0ABZ3HB17
LinkDB
Position
455950..456771
AA seq 273 aa
MNRLFVAYKPSGLSSNQFLRTLKRKYGVKKAGYSGTLDPFAKGVLIVAFGKYTSLFRFLD
KTPKRYRATLWLGAHSDTLDIEGVERIDDVAPLPEAKVREAVESLQGEQAYPPPIFSAKR
INGKRAYDLARAGIPFELETIRSKVYDVKLLHYCHPFVTFEATVSEGTYIRSLGRLVYER
LGLEGGSLSMLERLCEGQFVYEGEKPLDIRGALRVPPIEYRGEWRKITLGQPLTRDEFAP
GEDGFYRVDDGRELSIFSFDAEGVHYVLNKVAL
NT seq 822 nt   +upstreamnt  +downstreamnt
atgaacagactttttgtcgcctacaagccctccgggctcagttccaaccagttcctgcgg
accctcaagcgcaaatacggggtgaaaaaggcgggctactcggggaccctcgaccccttt
gcaaagggggtgctcattgtcgccttcggcaaatacacctcgcttttccgctttctcgac
aaaacccccaagcgctaccgggcgacgctctggctcggggcgcactccgataccctagat
atcgaaggggtcgagcgcatcgacgacgtcgcgccgctgccggaagcaaaggtccgagag
gccgtcgaatcgctgcagggggagcaggcctacccgccgccgattttcagcgcgaagcgg
atcaacgggaagcgtgcctatgacctggcacgggcgggcatcccctttgagctggagacg
atccgctcaaaggtctacgacgtcaagctgctgcactactgccacccctttgtgactttc
gaggccacggtctccgaggggacctatatccgttcgctcggacggctcgtgtacgagcgg
ctcggcctcgaggggggatcgctcagtatgcttgaacgtctttgcgaggggcagtttgtc
tacgagggggagaagcccctcgatatccgcggtgcgctgcgcgttcctccgatcgaatac
cggggggagtggcgcaagatcaccctggggcagccgctgacgcgtgacgagttcgccccc
ggcgaggatggcttctaccgcgttgatgacgggcgggagctctccatcttctcctttgac
gccgagggcgtgcattacgtgttgaacaaggtggcattatga

DBGET integrated database retrieval system