Sphingobacterium daejeonense: NCTC13534_02766 Help Entry NCTC13534_02766   CDS       T06632                                  Symbol aspC_1 Name (GenBank) Aspartate aminotransferase   KO K00812   aspartate aminotransferase [EC:2.6.1.1] Organism sdj  Sphingobacterium daejeonense Pathway sdj00220   Arginine biosynthesis sdj00250   Alanine, aspartate and glutamate metabolism sdj00270   Cysteine and methionine metabolism sdj00330   Arginine and proline metabolism sdj00350   Tyrosine metabolism sdj00360   Phenylalanine metabolism sdj00400   Phenylalanine, tyrosine and tryptophan biosynthesis sdj00401   Novobiocin biosynthesis sdj01100   Metabolic pathways sdj01110   Biosynthesis of secondary metabolites sdj01210   2-Oxocarboxylic acid metabolism sdj01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:sdj00001]  09100 Metabolism   09105 Amino acid metabolism    00250 Alanine, aspartate and glutamate metabolism     NCTC13534_02766 (aspC_1)    00270 Cysteine and methionine metabolism     NCTC13534_02766 (aspC_1)    00220 Arginine biosynthesis     NCTC13534_02766 (aspC_1)    00330 Arginine and proline metabolism     NCTC13534_02766 (aspC_1)    00350 Tyrosine metabolism     NCTC13534_02766 (aspC_1)    00360 Phenylalanine metabolism     NCTC13534_02766 (aspC_1)    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     NCTC13534_02766 (aspC_1)   09110 Biosynthesis of other secondary metabolites    00401 Novobiocin biosynthesis     NCTC13534_02766 (aspC_1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01007 Amino acid related enzymes [BR:sdj01007]     NCTC13534_02766 (aspC_1) Enzymes [BR:sdj01000]  2. Transferases   2.6  Transferring nitrogenous groups    2.6.1  Transaminases     2.6.1.1  aspartate transaminase      NCTC13534_02766 (aspC_1) Amino acid related enzymes [BR:sdj01007]  Aminotransferase (transaminase)   Class I    NCTC13534_02766 (aspC_1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Aminotran_1_2 Coat_F Motif Other DBs NCBI-ProteinID:  VTP97497 LinkDB All DBs Position 1:complement(2326031..2326291) Genome browser AA seq 86 aa AA seqDB search MDENWTRYSPVSGYPELRQAIVNKLKNENGLDYDISNIVVSTGAKQSLSNVLLTLVNPGD EVNHSYTILGFLFRNGRPSRRKVCIY NT seq 261 nt NT seq  +upstreamnt  +downstreamnt ttggatgagaactggacacgctactctcctgtttctggttatcctgaacttcgccaagca atcgtaaataaattaaagaatgaaaatggcttagattacgacatctcaaatatcgtcgtt tctacaggtgcgaaacaatccctttcaaatgtattgttaaccttggtgaatccaggagat gaagttaatcattcctacaccatattgggtttcttattcagaaatggtcgtcctagcaga aggaaagtctgtatttattga

DBGET integrated database retrieval system