KEGG   Sphingobacterium daejeonense: NCTC13534_05363
Entry
NCTC13534_05363   CDS       T06632                                 
Symbol
nuoJ_2
Name
(GenBank) NADH-quinone oxidoreductase subunit J
  KO
K00339  NADH-quinone oxidoreductase subunit J [EC:7.1.1.2]
Organism
sdj  Sphingobacterium daejeonense
Pathway
sdj00190  Oxidative phosphorylation
sdj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdj00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NCTC13534_05363 (nuoJ_2)
Enzymes [BR:sdj01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     NCTC13534_05363 (nuoJ_2)
SSDB
Motif
Pfam: Oxidored_q3 MbhD DUF6541 DUF7139 DUF5699 Acyl_transf_3 O-ag_pol_Wzy
Other DBs
NCBI-ProteinID: VTQ07724
LinkDB
Position
1:complement(4496554..4497060)
AA seq 168 aa
MTIFYFVAFLSIFFALMTIFTKNPVHSVLYLVITFFTFTVHYILLNAQFLAVVNFIVYMG
AIMVLFLFVLMLLNLNKDTEPMKSHLVKFMGAIAGMCLLATLLGAFRVLETNNEFVKASE
DLGLVKNLGKVLFKDFLLPFELSSILLLTAMVGAVLLAKKETRAKQNG
NT seq 507 nt   +upstreamnt  +downstreamnt
atgaccatattttattttgtagcgtttctatcgatcttctttgcgttgatgaccatcttc
acaaagaaccccgtgcatagtgtactctacctcgtaattacatttttcacctttacggtt
cattatatcctgctgaatgcgcagtttttggcggttgtgaattttatcgtctacatgggg
gccattatggttctattcctgtttgtgctgatgcttttgaacctcaacaaagataccgaa
ccgatgaaatcccatcttgtaaaattcatgggtgcgatcgccgggatgtgtctattggca
actttgttgggtgcatttagagtattggagaccaataatgagtttgtaaaggcttctgaa
gaccttggtctggtaaagaacctgggaaaagtattgtttaaggattttctgcttccattc
gaactgtcctcaattctgttgttgacagcgatggtaggagcagttttattggctaagaaa
gaaacacgagcgaaacaaaatgggtaa

DBGET integrated database retrieval system