Shewanella dokdonensis: KHX94_10185 Help Entry KHX94_10185       CDS       T07469                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sdk  Shewanella dokdonensis Pathway sdk01100   Metabolic pathways sdk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sdk00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KHX94_10185    00074 Mycolic acid biosynthesis     KHX94_10185   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KHX94_10185 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QVK21901 LinkDB All DBs Position 2116560..2116814 Genome browser AA seq 84 aa AA seqDB search MSLHNEIKQLIIDSLDLEDVSVADIETDAPLFGDGLGLDSIDALELGLAIKKQFDVKIEA NSEATRDHFYSVATLAKFIESQRV NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgagcttacataacgaaatcaagcaattgattattgatagtctggatttagaggatgtc agcgtggctgacatcgagactgacgcgccactttttggcgacggtttgggactggactct attgatgccttggagttgggactggcaattaaaaagcagtttgatgtcaagatcgaagcc aattctgaggctacccgtgatcacttttacagtgtcgcgacgttagctaagtttattgaa tcacagcgagtgtag

DBGET integrated database retrieval system