Sulfurospirillum deleyianum: Sdel_1836 Help Entry Sdel_1836         CDS       T01126                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sdl  Sulfurospirillum deleyianum Pathway sdl01100   Metabolic pathways sdl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sdl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Sdel_1836    00074 Mycolic acid biosynthesis     Sdel_1836   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Sdel_1836 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Motif Other DBs NCBI-ProteinID:  ACZ12851 UniProt:  D1B431 LinkDB All DBs Position complement(1863863..1864093) Genome browser AA seq 76 aa AA seqDB search MALFDDVKAVVVEQLNVNPDEVKEESKFVEDLGADSLDVVELVMALEEKFDIEIPDTDAE KIVTVKDAMSYIEAHK NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggcactatttgatgatgtaaaagcagttgttgttgaacaattgaatgttaatcctgac gaggtaaaagaggagtcaaaatttgtagaagatttgggcgctgactcacttgacgttgtt gaactcgttatggctcttgaagagaaatttgacattgagattccagatactgacgctgaa aaaatcgtcactgttaaagacgcaatgtcttacattgaagcacacaaataa

DBGET integrated database retrieval system