Sulfurospirillum deleyianum: Sdel_2109 Help Entry Sdel_2109         CDS       T01126                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sdl  Sulfurospirillum deleyianum Pathway sdl01100   Metabolic pathways sdl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sdl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Sdel_2109    00074 Mycolic acid biosynthesis     Sdel_2109   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Sdel_2109 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ACZ13121 UniProt:  D1B4V1 LinkDB All DBs Position 2119094..2119363 Genome browser AA seq 89 aa AA seqDB search MPNAHFDVLKYELKALILKECDKEEFSPEDIDDDAPLFGSDAPLQLDSMDALQISMALKE KYGVEITDSKKIRSIMSSITTLTHFIEAR NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgcccaacgctcattttgatgtactcaaatacgaactcaaagccctcatcctaaaagag tgcgacaaagaggaatttagccctgaggatatcgacgatgacgcacctctttttggctca gatgcacctttacaactcgattcgatggatgcgctgcaaatctctatggcactcaaagag aagtacggtgttgagattaccgatagtaaaaaaattcgctccattatgagtagtatcacc actttaacacactttattgaggcacgatga

DBGET integrated database retrieval system