Stegodyphus dumicola: 118191069 Help Entry 118191069         CDS       T07385                                  Name (RefSeq) ras-like GTP-binding protein RHO   KO K04513   Ras homolog gene family, member A Organism sdm  Stegodyphus dumicola Pathway sdm04081   Hormone signaling sdm04144   Endocytosis sdm04150   mTOR signaling pathway sdm04310   Wnt signaling pathway sdm04350   TGF-beta signaling pathway sdm04517   IgSF CAM signaling sdm04519   Cadherin signaling sdm05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:sdm00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     118191069    04350 TGF-beta signaling pathway     118191069    04150 mTOR signaling pathway     118191069   09133 Signaling molecules and interaction    04081 Hormone signaling     118191069    04517 IgSF CAM signaling     118191069    04519 Cadherin signaling     118191069  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     118191069  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     118191069  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sdm04131]     118191069   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sdm04147]     118191069    04031 GTP-binding proteins [BR:sdm04031]     118191069 Membrane trafficking [BR:sdm04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     118191069 Exosome [BR:sdm04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    118191069   Exosomal proteins of other body fluids (saliva and urine)    118191069   Exosomal proteins of colorectal cancer cells    118191069   Exosomal proteins of bladder cancer cells    118191069 GTP-binding proteins [BR:sdm04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     118191069 SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA Motif Other DBs NCBI-GeneID:  118191069 NCBI-ProteinID:  XP_035217753 LinkDB All DBs Position Unknown AA seq 191 aa AA seqDB search MATIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEIDGELVQLALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDNPDSLANISDKWNPEVRHFCPSVPVILVGNKCD LRYDEEALYQLGSMAQKPVTFQQGCATSEAIRAYAYVECSAKTKEGVRDVFEIATRAALH IKRKRKLCTFL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atggctactattcgaaagaagttagttattgtcggcgacggcgcttgcgggaaaacttgt ctattgatcgtctttagtaaagaccaattcccagaggtttatgtccctactgtgtttgaa aattatgtagcagacatcgaaatagatggggaattagtccagttagctttatgggatact gcaggacaagaggactacgacaggttgcgccctctttcttacccagatacggatgtcatc ctcatgtgttttagcatcgacaatccagacagcctggcgaacatttctgacaaatggaat cctgaagtaagacatttttgccccagcgtgcctgtcattttagtcggcaataaatgcgat ttgaggtatgatgaagaagctctgtatcagctgggttcgatggctcagaagccggtgaca tttcagcaaggttgtgccacgtctgaagctattcgtgcctatgcttatgtggaatgttcg gccaagaccaaagaaggagtaagggatgtctttgagatagccacaagagcagcactgcat ataaaaagaaaacgaaagctctgcacttttctctga

DBGET integrated database retrieval system