Stegodyphus dumicola: 118196048 Help Entry 118196048         CDS       T07385                                  Name (RefSeq) cystatin-A2-like   KO K13907   cystatin-A/B Organism sdm  Stegodyphus dumicola Brite KEGG Orthology (KO) [BR:sdm00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:sdm01002]     118196048   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sdm04147]     118196048 Peptidases and inhibitors [BR:sdm01002]  Peptidase inhibitors   Family I25: cystatin family    118196048 Exosome [BR:sdm04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    118196048 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cystatin Dynein_light Motif Other DBs NCBI-GeneID:  118196048 NCBI-ProteinID:  XP_035223309 LinkDB All DBs Position Unknown AA seq 98 aa AA seqDB search MSAMVGGTGEVREPDENIHQITREIKNEVQSKTGLLFEEFVPLKYRSQLVNGTNYFIKVK YGPNQHMHLRVHRSFQGAVTLAAFQLDKTLEDELEYFQ NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgtcagcgatggtaggaggaactggagaagttcgcgaaccagacgaaaatattcatcag attactagagaaataaaaaatgaagttcagtctaaaacaggtcttctgtttgaagagttt gtccctctaaagtatcgaagtcagttggtaaatgggacaaattattttattaaggtgaaa tatggacccaaccaacatatgcatttgcgtgtccacaggagtttccagggtgctgtaact cttgctgcattccaattggataaaacattggaggatgaattggagtacttccaataa

DBGET integrated database retrieval system