Shewanella denitrificans: Sden_1276 Help Entry Sden_1276         CDS       T00344                                  Name (GenBank) Cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism sdn  Shewanella denitrificans Pathway sdn00190   Oxidative phosphorylation sdn01100   Metabolic pathways sdn02020   Two-component system Module sdn_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:sdn00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     Sden_1276  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     Sden_1276 Enzymes [BR:sdn01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      Sden_1276 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  ABE54562 UniProt:  Q12PR4 LinkDB All DBs Position 1494095..1494214 Genome browser AA seq 39 aa AA seqDB search MWYFAWILGVLLACSFGIINALWLENTENLDRLSDDSED NT seq 120 nt NT seq  +upstreamnt  +downstreamnt atgtggtattttgcgtggatcttaggggtcttgctcgcctgctcatttgggatcattaat gccctctggcttgagaatactgagaatctagacagactgtctgacgacagtgaagattaa

DBGET integrated database retrieval system