Sphingomonas donggukensis: M9980_01540 Help Entry M9980_01540       CDS       T08944                                  Name (GenBank) ATP synthase F1 subunit epsilon   KO K02114   F-type H+-transporting ATPase subunit epsilon Organism sdon  Sphingomonas donggukensis Pathway sdon00190   Oxidative phosphorylation sdon01100   Metabolic pathways Module sdon_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:sdon00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     M9980_01540  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:sdon00194]     M9980_01540 Photosynthesis proteins [BR:sdon00194]  Photosystem and electron transport system   F-type ATPase [OT]    M9980_01540 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_DE_N Motif Other DBs NCBI-ProteinID:  URW75941 LinkDB All DBs Position complement(332846..333100) Genome browser AA seq 84 aa AA seqDB search MLHFELVTPEKLVRSEDVYMVVVPGTEGDFGVLEGHAPLMSTIRDGELAIYKTQGSSPET IRIEGGFAEVNGVGLVVLAETVAA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgctgcacttcgaactcgtcacgcctgaaaagctcgtccggtcggaggacgtgtacatg gtcgtcgtccccggcaccgaaggcgacttcggcgtgcttgagggccatgcgccgctgatg tcgacgatccgcgacggcgaactcgcgatttacaagacgcaagggtcgagccccgagacg atccgcatcgagggcggttttgccgaggtgaacggcgtcgggctggtggtgctggcggag accgtggcggcttaa

DBGET integrated database retrieval system