KEGG   Sphingomonas donggukensis: M9980_05995
Entry
M9980_05995       CDS       T08944                                 
Name
(GenBank) response regulator
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
sdon  Sphingomonas donggukensis
Pathway
sdon02020  Two-component system
sdon02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:sdon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    M9980_05995
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    M9980_05995
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:sdon02022]
    M9980_05995
   02035 Bacterial motility proteins [BR:sdon02035]
    M9980_05995
Two-component system [BR:sdon02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   M9980_05995
Bacterial motility proteins [BR:sdon02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    M9980_05995
SSDB
Motif
Pfam: Response_reg Receiver_CRE1
Other DBs
NCBI-ProteinID: URW76753
UniProt: A0ABY4U2H4
LinkDB
Position
complement(1229706..1230071)
AA seq 121 aa
MKTCLVVDDSKVIRKVARHILETLDFEVREAGDGREALDACMATPPDVILLDWNMPVMSG
MDFLRALRDTDIGSKPKVVFCTTENGMAYIRAAIEAGADEYVMKPFDRETLESKLQIVGM
A
NT seq 366 nt   +upstreamnt  +downstreamnt
atgaagacctgcctcgtcgtcgacgattccaaggtgatccgcaaggtcgcccgtcacatc
ctcgaaaccctcgatttcgaggtgcgcgaggccggtgacggtcgtgaggcgctcgatgcc
tgcatggcgacgccgcccgacgtgatcctgctcgactggaacatgccggtgatgagcggc
atggatttcctgcgcgcgctgcgcgacaccgacatcggatcgaagccgaaggtcgtgttc
tgcacgaccgagaacggcatggcctatatccgcgccgcgatcgaggcgggcgccgacgaa
tatgtcatgaagccgttcgatcgcgaaacgctagagagcaaactccagatcgtcggcatg
gcctga

DBGET integrated database retrieval system