Sulfuricella denitrificans: SCD_n01532 Help Entry SCD_n01532        CDS       T02857                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sdr  Sulfuricella denitrificans Pathway sdr01100   Metabolic pathways sdr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sdr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SCD_n01532    00074 Mycolic acid biosynthesis     SCD_n01532   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SCD_n01532 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 DUF1493 DUF5783 Ribosomal_L50 DUF6137 Motif Other DBs NCBI-ProteinID:  BAN35354 UniProt:  S6AL46 LinkDB All DBs Position complement(1545370..1545606) Genome browser AA seq 78 aa AA seqDB search MENIEQRVKKIVAEQLGVNEAEVKIESSFVDDLGADSLDTVELVMALEEEFDCEIPDEEA EKITTVKQAVDYVNGHLN NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggaaaatatcgaacaacgcgtcaaaaaaatcgttgctgagcaacttggcgtgaacgaa gcagaagtaaagattgaatcctccttcgtcgacgacctgggcgctgattccctggatacc gttgagctggtcatggcactggaagaagagttcgactgcgaaattcctgacgaagaagcg gaaaaaatcaccaccgtcaaacaagccgttgattacgtcaatggtcatctgaactaa

DBGET integrated database retrieval system