Sulfuricella denitrificans: SCD_n03069 Help Entry SCD_n03069        CDS       T02857                                  Symbol atpE Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism sdr  Sulfuricella denitrificans Pathway sdr00190   Oxidative phosphorylation sdr01100   Metabolic pathways Module sdr_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:sdr00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     SCD_n03069 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:sdr00194]     SCD_n03069 (atpE) Photosynthesis proteins [BR:sdr00194]  Photosystem and electron transport system   F-type ATPase [OT]    SCD_n03069 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Virul_fac_BrkB Motif Other DBs NCBI-ProteinID:  BAN36868 UniProt:  S6AE17 LinkDB All DBs Position pSCD:complement(33321..33587) Genome browser AA seq 88 aa AA seqDB search MDKMTWFTLLSTGGALAAIAVGVIFPAIAMGRAITQALDALARQPEAEKAISRTLFIGLA MIESLAIYVLVIVLIVLFRNPLLEYLLK NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggacaagatgacctggtttaccctgctttccaccggcggtgcgcttgccgccatcgcc gtcggtgtgatctttccggccatcgccatggggcgtgccatcacccaggcgctggacgcc ctggcgcgccagcccgaggccgagaaggcgatctcgcgcacgctgttcatcggcctggcg atgatcgaatcactggcgatttacgtgctggtgattgtactcatcgtgctgttccgcaac ccgctgctcgaatacctgctgaagtag

DBGET integrated database retrieval system