Streptomyces drozdowiczii: NEH16_32485 Help Entry NEH16_32485       CDS       T09042                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism sdrz  Streptomyces drozdowiczii Pathway sdrz00253   Tetracycline biosynthesis sdrz01056   Biosynthesis of type II polyketide backbone sdrz01100   Metabolic pathways sdrz01110   Biosynthesis of secondary metabolites Module sdrz_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite KEGG Orthology (KO) [BR:sdrz00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     NEH16_32485    00253 Tetracycline biosynthesis     NEH16_32485  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:sdrz01004]     NEH16_32485    01008 Polyketide biosynthesis proteins [BR:sdrz01008]     NEH16_32485 Lipid biosynthesis proteins [BR:sdrz01004]  Polyketide synthase   Component type    NEH16_32485 Polyketide biosynthesis proteins [BR:sdrz01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      NEH16_32485     Nonaketide PKS      NEH16_32485     Decaketide PKS      NEH16_32485 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  UZK58176 LinkDB All DBs Position complement(7192094..7192357) Genome browser AA seq 87 aa AA seqDB search MDRLNLTDLAALLRDAAGSDEGVPLDEAAQDTLFLDLGYDSLALLQVTGVIERDHDVALD EEALDEAQTPRAYLDLVNGALAARTAA NT seq 264 nt NT seq  +upstreamnt  +downstreamnt gtggaccgcctgaacctgaccgaccttgccgccctgctgcgcgacgccgccggcagcgac gagggcgtgccgctggacgaggccgcccaggacaccctcttcctcgacctcggctacgac tcgctggccctgctccaggtcaccggcgtcatcgagcgcgatcacgacgtggcgctggac gaggaggcgctggacgaggcgcagaccccgcgcgcgtacctcgacctcgtcaacggggcg ctggccgcccggacggcggcctga

DBGET integrated database retrieval system