Seriola dumerili (greater amberjack): 111216692 Help Entry 111216692         CDS       T05606                                  Symbol ubl5 Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism sdu  Seriola dumerili (greater amberjack) Brite KEGG Orthology (KO) [BR:sdu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:sdu03041]     111216692 (ubl5)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:sdu04052]     111216692 (ubl5) Spliceosome [BR:sdu03041]  Complex B   Other components    Complex B specific factors     111216692 (ubl5) Cytokines and neuropeptides [BR:sdu04052]  Neuropeptides   Unclassified    111216692 (ubl5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler Motif Other DBs NCBI-GeneID:  111216692 NCBI-ProteinID:  XP_022594028 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MIEVVCNDRLGKKVRVKCNSEDTIGDLKKLIAAQTGTRYDKIVLKKWYTIFKDHVSLGDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggtggtctgcaatgatcgtctgggcaagaaagtccgggtcaagtgcaactca gaggataccattggagatctgaagaagctcattgctgcccagacaggaacacggtacgac aagattgtattaaagaaatggtataccatattcaaggatcacgtgtctttgggtgactat gaaatccatgatgggatgaaccttgagctgtactaccagtag

DBGET integrated database retrieval system