Seriola dumerili (greater amberjack): 111217084 Help Entry 111217084         CDS       T05606                                  Symbol hmgb1 Name (RefSeq) high mobility group protein B1   KO K10802   high mobility group protein B1 Organism sdu  Seriola dumerili (greater amberjack) Pathway sdu03410   Base excision repair sdu04140   Autophagy - animal sdu04217   Necroptosis Brite KEGG Orthology (KO) [BR:sdu00001]  09120 Genetic Information Processing   09124 Replication and repair    03410 Base excision repair     111217084 (hmgb1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     111217084 (hmgb1)   09143 Cell growth and death    04217 Necroptosis     111217084 (hmgb1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sdu03036]     111217084 (hmgb1)    03400 DNA repair and recombination proteins [BR:sdu03400]     111217084 (hmgb1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sdu04147]     111217084 (hmgb1) Chromosome and associated proteins [BR:sdu03036]  Eukaryotic type   Nucleosome assembly factors    HMG (high mobility group) proteins     111217084 (hmgb1) DNA repair and recombination proteins [BR:sdu03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Other BER factors      111217084 (hmgb1)    MMR (mismatch excision repair)     Other MMR factors      111217084 (hmgb1) Exosome [BR:sdu04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    111217084 (hmgb1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HMG_box HMG_box_2 HMG_WDHD1 HMG_box_5 NOA36 Motif Other DBs NCBI-GeneID:  111217084 NCBI-ProteinID:  XP_022594514 LinkDB All DBs Position Unknown AA seq 206 aa AA seqDB search MGKDPTKPRGKMSSYAYFVQTCREEHKKKHPDASVNFAEFSKKCSERWKTMSAKEKGKFE DLARQDKARYEREMMSYVPVRGGKKKKFKDPNAPKRPPSAFFIFCSEFRPKVKGESPGLS IGDVAKRLGEMWNSTAAEDKQPYEKKAAKLKEKYEKDIAAYRAKGKTGGGAPGKAPSKAE KKDDDDDDDDEDDEEEEEDDDDDDDE NT seq 621 nt NT seq  +upstreamnt  +downstreamnt atggggaaagatccaaccaagccgagggggaagatgtcctcctatgcatattttgtccag acctgccgggaggagcacaagaagaagcaccctgatgcttcggttaactttgccgagttt tccaagaagtgctctgagcgatggaagacaatgtctgctaaggagaagggcaaatttgag gatctggccagacaggacaaggcgcgctatgagagggagatgatgagctacgttccagtc aggggaggaaagaagaagaagttcaaggaccctaatgcccccaagagacctccatctgcc ttcttcatcttttgctcagagttccgccctaaggtgaaaggcgagagccctggtctgtcc attggagatgttgccaagaggctgggtgagatgtggaacagcaccgctgcagaggacaag cagccttatgagaagaaggccgctaaactgaaggagaagtacgagaaggacatcgcagca taccgcgctaagggcaaaacaggtggcggagcaccaggaaaagccccgtccaaggcagag aagaaggatgacgatgacgacgatgatgatgaagatgacgaggaggaggaggaggatgat gatgatgatgatgatgagtag

DBGET integrated database retrieval system