Seriola dumerili (greater amberjack): 111219957 Help Entry 111219957         CDS       T05606                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism sdu  Seriola dumerili (greater amberjack) Pathway sdu04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:sdu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     111219957  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:sdu04121]     111219957    03400 DNA repair and recombination proteins [BR:sdu03400]     111219957 Ubiquitin system [BR:sdu04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      111219957    Cul5 complex      111219957 DNA repair and recombination proteins [BR:sdu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      111219957 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  111219957 NCBI-ProteinID:  XP_022598558 LinkDB All DBs Position Unknown AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRPPEDQRLYKDDQLLEDSKTLGDC GFTNQTARPQAPATVGLAFRVNDEMFEQLHIEAFSSPPELPDVMKPQDSGSTANEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggacgtgttcttaatgattcgacgtcacaagactacaatcttcacagatgccaaggag tccactactgtctatgagctgaagcgtattgttgaaggaatccttaaaagaccacctgaa gaccagcggctttacaaagatgaccagttgttagaagacagcaaaactctgggtgactgt ggattcaccaaccagactgccagacctcaagccccagctacagttggtctggccttccgc gtaaatgatgagatgtttgagcagctgcacattgaggccttctccagccccccagaactc cctgatgtgatgaagcctcaggactccggtagcactgccaacgaacaggcggtgcagtga

DBGET integrated database retrieval system