Seriola dumerili (greater amberjack): 111221135 Help Entry 111221135         CDS       T05606                                  Name (RefSeq) histone H2A-like   KO K11251   histone H2A Organism sdu  Seriola dumerili (greater amberjack) Pathway sdu03082   ATP-dependent chromatin remodeling sdu04217   Necroptosis Brite KEGG Orthology (KO) [BR:sdu00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     111221135  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     111221135  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sdu03036]     111221135   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sdu04147]     111221135 Chromosome and associated proteins [BR:sdu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     111221135 Exosome [BR:sdu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    111221135 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  111221135 NCBI-ProteinID:  XP_022600193 LinkDB All DBs Position Unknown AA seq 128 aa AA seqDB search MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TEKTAKSK NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atgagcggacgcggcaaaaccggtggaaaagccagagctaaggccaagacccgctcctcc cgggccgggctccagttcccggtcggccgtgttcacaggctgctgcgcaaaggaaactac gcgcagcgtgtgggtgccggcgcccccgtctacctggcggcggtgctggagtacctgacc gctgagatcctggagctggctggaaacgccgcccgcgacaacaagaagacccgtatcatc ccccgccacctgcagctggccgtccgcaacgacgaggagctcaacaaactcctgggcgga gtgaccatcgctcagggaggcgtgctgcccaacatccaggctgttctgctgcccaagaag acggagaagaccgccaagtccaagtaa

DBGET integrated database retrieval system